PDB entry 6scp

View 6scp on RCSB PDB site
Description: cell division protein sepf in complex with c-terminal domain of ftsz
Deposited on 2019-07-25, released 2020-03-11
The last revision was dated 2020-09-23, with a file datestamp of 2020-09-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein sepf
    Species: CORYNEBACTERIUM GLUTAMICUM ATCC 13032 [TaxId:196627]
    Gene: sepF, Cgl2152
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NNN6 (1-End)
      • initiating methionine (0)
  • Chain 'B':
    Compound: cell division protein sepf
    Species: CORYNEBACTERIUM GLUTAMICUM ATCC 13032 [TaxId:196627]
    Gene: sepF, Cgl2152
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NNN6 (1-End)
      • initiating methionine (0)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6scpA (A:)
msyqstivpvelhsfedaqviggafrdgdavvfdmsllsreearrivdfaaglcfalrgk
mqkidsvtfavvpelsnistseleraarir

    Sequence, based on observed residues (ATOM records):
    >6scpA (A:)
msyqstivpvelhsfedaqviggafrdgdavvfdmsllsreearrivdfaaglcfalrgk
mqkidsvtfavvpelsnistseleraa

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6scpB (B:)
msyqstivpvelhsfedaqviggafrdgdavvfdmsllsreearrivdfaaglcfalrgk
mqkidsvtfavvpelsnistseleraarir

    Sequence, based on observed residues (ATOM records):
    >6scpB (B:)
msyqstivpvelhsfedaqviggafrdgdavvfdmsllsreearrivdfaaglcfalrgk
mqkidsvtfavvpelsnistseleraa