PDB entry 6sai

View 6sai on RCSB PDB site
Description: NMR solution structure of Hml-2 C-terminal dimer domain
Class: viral protein
Keywords: Human-endogenous-retroviruses, Retroviridae, Ortervirales., VIRAL PROTEIN
Deposited on 2019-07-16, released 2020-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag protein
  Species: Human endogenous retrovirus K [TaxId:45617]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P87891 (0-90)
    • expression tag (91-92)
  Domains in SCOPe 2.08: d6saia1, d6saia2
• Chain 'B':
  Compound: gag protein
  Species: Human endogenous retrovirus K [TaxId:45617]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P87891 (0-90)
    • expression tag (91-92)
  Domains in SCOPe 2.08: d6saib1, d6saib2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6saiA (A:)
  psfntvrqgskepypdfvarlqdvaqksiadekarkvivelmayenanpecqsaikplkg
  kvpagsdviseyvkacdgiggamhkamlmaqle
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6saiB (B:)
  psfntvrqgskepypdfvarlqdvaqksiadekarkvivelmayenanpecqsaikplkg
  kvpagsdviseyvkacdgiggamhkamlmaqle