PDB entry 6saf

View 6saf on RCSB PDB site
Description: The Fk1 domain of FKBP51 in complex with (S)-(R)-3-(3,4-dimethoxyphenyl)-1-(3-(2-morpholinoethoxy)phenyl)propyl 1-((1R,4aR,8aR)-4-oxodecahydronaphthalene-1-carbonyl)piperidine-2-carboxylate
Class: chaperone
Keywords: Fk-506 binding domain, Hsp90 cochaperone, immunophiline, peptidyl-prolyl isomerase, ligand selectivity, chaperone
Deposited on 2019-07-16, released 2019-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP5, AIG6, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • engineered mutation (6)
    Domains in SCOPe 2.08: d6safa1, d6safa2
  • Heterogens: L2Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6safA (A:)
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge