PDB entry 6s93

View 6s93 on RCSB PDB site
Description: Crystal structure of group B of Usutu virus envelope protein domain III
Class: viral protein
Keywords: DIII, Usutu virus, USUV, envelope protein, VIRAL PROTEIN
Deposited on 2019-07-11, released 2020-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Usutu virus [TaxId:64286]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6s93a_
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Usutu virus [TaxId:64286]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6s93b_
  • Chain 'C':
    Compound: Genome polyprotein
    Species: Usutu virus [TaxId:64286]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6s93c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6s93A (A:)
gttysmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvta
npyvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkag

    Sequence, based on observed residues (ATOM records): (download) 
    >6s93A (A:)
ttysmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvtan
pyvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkag

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6s93B (B:)
gttysmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvta
npyvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkag

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6s93C (C:)
gttysmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvta
npyvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkag