PDB entry 6s8c

View 6s8c on RCSB PDB site
Description: Post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem
Class: viral protein
Keywords: envelope protein, membrane fusion, stem, virus/viral protein, viral protein
Deposited on 2019-07-09, released 2020-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein,Genome polyprotein
    Species: Tick-borne encephalitis virus [TaxId:11084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6s8ca1
  • Chain 'B':
    Compound: Genome polyprotein,Genome polyprotein
    Species: Tick-borne encephalitis virus [TaxId:11084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6s8cb1, d6s8cb2
  • Chain 'C':
    Compound: Genome polyprotein,Genome polyprotein
    Species: Tick-borne encephalitis virus [TaxId:11084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6s8cc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6s8cA (A:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrghgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigrvfqgggsgggsggflssig
    kavhtvlggafnsigpfeddddkagwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6s8cA (A:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklcvkaaceakkkatghvydankivytvkvephhsgrktasftissektiltmgeygd
    vsllcrvasgvdlaqtvileldkthlptawqvhrdwfndlalpwkhegaqnwnnaerlve
    vynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgltytmcdktkft
    wkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnptienngggfie
    mqlppgdniiyvgelshqwfqkgssigrvfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6s8cB (B:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrghgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigrvfqgggsgggsggflssig
    kavhtvlggafnsigpfeddddkagwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6s8cB (B:)
    rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
    haklsdtkehqggtvckacvkaaceakkkatghvydankivytvkvephrktasftisse
    ktiltmgeygdvsllcrvasgvdlaqtvileldptawqvhrdwfndlalpwkhegaqnwn
    naerlvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevglek
    lkmkgltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvam
    litpnptienngggfiemqlppgdniiyvgelshqwfqkgssigrvfqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6s8cC (C:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrghgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigrvfqgggsgggsggflssig
    kavhtvlggafnsigpfeddddkagwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6s8cC (C:)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkgtvckvacvkaaceakkkatghvydankivytvkvephrktasftissekt
    iltmgeygdvsllcrvasgvdlaqtvileldklptawqvhrdwfndlalpwkhegaqnwn
    naerlvefdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkglty
    tmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnpti
    enngggfiemqlppgdniiyvgelshqwfqkgssigrvf