PDB entry 6s89

View 6s89 on RCSB PDB site
Description: Crystal Structure of EGFR-T790M/C797S in Complex with Covalent Pyrrolopyrimidine 19g
Class: transferase
Keywords: EGFR, T790M/C797S, covalent Pyrrolopyrimide, TRANSFERASE
Deposited on 2019-07-09, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (100)
      • engineered mutation (107)
      • engineered mutation (175-177)
    Domains in SCOPe 2.07: d6s89a_
  • Heterogens: L0Q, MES

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6s89A (A:)
    gshmasgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelre
    atspkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdni
    gsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaaaaey
    haeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilek
    gerlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhl
    psptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6s89A (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaaaaeyhaeggkv
    pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
    pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdefyralmdeedm
    ddvvdadeyl