PDB entry 6s6r

View 6s6r on RCSB PDB site
Description: first crystal structure of parasitic pex14 in complex with a fragment molecule 1h-indole-7-carboxylic acid
Deposited on 2019-07-03, released 2020-07-15
The last revision was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxin 14
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: Pex14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IEW2 (3-68)
      • expression tag (0-2)
      • engineered mutation (3)
  • Heterogens: KXQ, SO4, GOL, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6s6rA (A:)
gamwhthserekrvsnaveflldsrvrrtptsskvhflkskglsaeeiceaftkvgqpkt
lneikrils