PDB entry 6s5s

View 6s5s on RCSB PDB site
Description: cfucosylated second generation peptide dendrimer sbd8 bound to fucose binding lectin lecb (pa-iil) from pseudomonas aeruginosa at 1.43 angstrom resolution
Deposited on 2019-07-02, released 2019-08-21
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fucose-binding lectin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: lecB, C0044_25260, CAZ10_21840, DT376_00595, DY979_15445, ECC04_10105, EFK27_13700, EGV95_09240, EGY23_15550, IPC669_23070, PA5486_01888, PAERUG_E15_London_28_01_14_00983, PAMH19_1713, RW109_RW109_02453
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A069Q9V4 (Start-114)
• Chain 'B':
  Compound: SBD8 chain B
  Species: UNIDENTIFIED, synthetic [TaxId:32644]
  Database cross-references and differences (RAF-indexed):
  • PDB 6S5S (Start-6)
• Chain 'C':
  Compound: SBD8 chain C
  Species: UNIDENTIFIED, synthetic [TaxId:32644]
  Database cross-references and differences (RAF-indexed):
  • PDB 6S5S (0-2)
• Chain 'D':
  Compound: SBD8 chain D
  Species: UNIDENTIFIED, synthetic [TaxId:32644]
  Database cross-references and differences (RAF-indexed):
  • PDB 6S5S (0-5)
• Chain 'E':
  Compound: SBD8 chain C
  Species: UNIDENTIFIED, synthetic [TaxId:32644]
  Database cross-references and differences (RAF-indexed):
  • PDB 6S5S (0-2)
• Heterogens: ZDC, CA, NH2, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence, based on SEQRES records:
  

  >6s5sA (A:)
  matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
  sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6s5sA (A:)
  atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
  gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6s5sB (B:)
  kplafka
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6s5sB (B:)
  plafka
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6s5sC (C:)
  kpl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >6s5sD (D:)
  kplafk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records:
  

  >6s5sE (E:)
  kpl