PDB entry 6s45

View 6s45 on RCSB PDB site
Description: Room temperature structure of the dark state of the LOV2 domain of phototropin-2 from Arabidopsis thaliana determined with a serial crystallography approach
Class: plant protein
Keywords: LOV Domain, photoactive protein, flavoprotein, time-resolved crystallography, PLANT PROTEIN
Deposited on 2019-06-26, released 2020-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phototropin-2
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: PHOT2, CAV1, KIN7, NPL1, At5g58140, K21L19.6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P93025 (1-105)
    • initiating methionine (0)
    • expression tag (106-115)
  Domains in SCOPe 2.08: d6s45a1, d6s45a2
• Heterogens: FMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6s45A (A:)
  meknfvisdprlpdnpiifasdsflelteysreeilgrncrflqgpetdqatvqkirdai
  rdqreitvqlinytksgkkfwnlfhlqpmrdqkgelqyfigvqldgefipnpllgldstr
  tghhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6s45A (A:)
  meknfvisdprlpdnpiifasdsflelteysreeilgrncrflqgpetdqatvqkirdai
  rdqreitvqlinytksgkkfwnlfhlqpmrdqkgelqyfigvqldgefipnpllgl