PDB entry 6s3w

View 6s3w on RCSB PDB site
Description: solution nmr structure of tolaiii bound to a peptide derived from the n-terminus of tolb
Deposited on 2019-06-26, released 2020-03-25
The last revision was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell envelope integrity/translocation protein TolA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: EFK27_03855
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TolBp
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • PDB 6S3W (0-12)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6s3wA (A:)
hmralaellsdtterqqaladevgsevtgslddlivnlvsqqwrrppsarngmsvevlie
mlpdgtitnasvsrssgdkpfdssavaavrnvgripemqqlpratfdslyrqrriifkpe
dlsl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6s3wB (B:)
adplvissgndra