PDB entry 6s2z

View 6s2z on RCSB PDB site
Description: Water-soluble Chlorophyll Protein (WSCP) from Brassica oleracea var. Botrytis with Chlorophyll-b
Class: plant protein
Keywords: Tetramer, Plant, Brassica oleracea, Chlorophyll, Water-soluble Chlorophyll Protein, Photooxidation, Chlorophyll Carrier, Plant Protein
Deposited on 2019-06-23, released 2019-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Water-soluble chlorophyll protein
    Species: Brassica oleracea var. botrytis [TaxId:3715]
    Gene: WSCP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6s2za_
  • Heterogens: CHL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6s2zA (A:)
    reqvkdsngnpvkrgakyfiqpaksnggglvpaainilpfcplgitqtllpyqpglpvsf
    gyepvivgtdyiytsttiniefrseiwpvcnelsklwavdvsssaakepaiiiggertap
    nslfkieeatgahtyklttssgtvgtipgpwlgapqliatnddaktlfvkfvkvdddat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6s2zA (A:)
    reqvkdsngnpvkrgakyfiqpaksnggglvpaainilpfcplgitqtllpyqpglpvsf
    gyepvivgtdyiytsttiniefrseiwpvcnelsklwavdvsssaakepaiiiggertap
    nslfkieeatgahtyklttssgtvgtipgpwlgapqliatnddaktlfvkfvkvd