PDB entry 6s1w

View 6s1w on RCSB PDB site
Description: Crystal structure of dimeric M-PMV protease D26N mutant
Class: hydrolase
Keywords: Mason-Pfizer Monkey Virus, M-PMV, retrovirus, retropepsin, aspartic protease, dimerization, flap structure, apo, HYDROLASE
Deposited on 2019-06-19, released 2019-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag-pro-pol polyprotein
    Species: Mason-Pfizer monkey virus [TaxId:11855]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07572 (0-End)
      • engineered mutation (25)
    Domains in SCOPe 2.08: d6s1wa_
  • Chain 'B':
    Compound: gag-pro-pol polyprotein
    Species: Mason-Pfizer monkey virus [TaxId:11855]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07572 (0-End)
      • engineered mutation (25)
    Domains in SCOPe 2.08: d6s1wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6s1wA (A:)
wvqpitcqkpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnn
pkqsskyltwrdkennsglikpfvipnlpvnlwgrdllsqmkimmcspndivta

    Sequence, based on observed residues (ATOM records): (download) 
    >6s1wA (A:)
wvqpitcqkpsltlwlddkmftglintgadvtiikledwppnwpitdtnpkqsskyltwr
dkennsglikpfvipnlpvnlwgrdllsqmkimmcsp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6s1wB (B:)
wvqpitcqkpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnn
pkqsskyltwrdkennsglikpfvipnlpvnlwgrdllsqmkimmcspndivta

    Sequence, based on observed residues (ATOM records): (download) 
    >6s1wB (B:)
wvqpitcqkpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnn
pkqsskyltwrdkennsglikpfvipnlpvnlwgrdllsqmkimmcsp