PDB entry 6s1d

View 6s1d on RCSB PDB site
Description: Structure of thaumatin determined at SwissFEL using native-SAD at 4.57 keV from 20,000 diffraction patterns
Class: plant protein
Keywords: native-SAD, Serial femtosecond crystallography, SFX, SwissFEL, Jungfrau, PLANT PROTEIN
Deposited on 2019-06-18, released 2020-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-02, with a file datestamp of 2020-11-27.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-1
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6s1da_
  • Heterogens: TLA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6s1dA (A:)
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta