PDB entry 6rze

View 6rze on RCSB PDB site
Description: crystal structure of e. coli adenylate kinase r119a mutant
Deposited on 2019-06-13, released 2019-08-07
The last revision was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: adk, D9E35_07195, D9H53_18240, D9H70_06005, D9I87_03740, EB509_06410, EB510_02065, EB515_08900, EC382_09075, ED225_07155, ED607_06260, ED611_06205, ED903_02730, ED944_09135, EEA45_02410, EF173_11005, EIA21_12240, NCTC10444_03756, NCTC9112_04001, NCTC9119_03910, NCTC9969_03944, SAMEA3472056_03545, SAMEA3485101_03900, SAMEA3485113_01288
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6rzeA (A:)
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdai
vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
yyskeaeagntkyakvdgtkpvaevradlekilg