PDB entry 6ryn

View 6ryn on RCSB PDB site
Description: Structure of conglutinin carbohydrate recognition domain with GlcNAc-alpha-1-phosphate bound
Class: immune system
Keywords: carbohydrate recognition domain, lectin, collectin, sugar binding protein, IMMUNE SYSTEM
Deposited on 2019-06-10, released 2019-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conglutinin
    Species: Bos taurus [TaxId:9913]
    Gene: CGN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ryna_
  • Heterogens: CA, GN1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6rynA (A:)
    kavlfpdgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqek
    naylsmndistegrftyptgeilvysnwadgepnnsdegqpencveifpdgkwndvpcsk
    qllvicef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rynA (A:)
    dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm
    ndistegrftyptgeilvysnwadgepnqpencveifpdgkwndvpcskqllvicef