PDB entry 6ryg

View 6ryg on RCSB PDB site
Description: native structure of conglutinin carbohydrate recognition domain
Class: immune system
Keywords: carbohydrate recognition domain, lectin, collectin, sugar binding protein, IMMUNE SYSTEM
Deposited on 2019-06-10, released 2019-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conglutinin
    Species: Bos taurus [TaxId:9913]
    Gene: CGN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ryga_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6rygA (A:)
kavlfpdgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqek
naylsmndistegrftyptgeilvysnwadgepnnsdegqpencveifpdgkwndvpcsk
qllvicef

    Sequence, based on observed residues (ATOM records): (download) 
    >6rygA (A:)
dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm
ndistegrftyptgeilvysnwadgepnpencveifpdgkwndvpcskqllvicef