PDB entry 6rxn

View 6rxn on RCSB PDB site
Description: the structure of rubredoxin from desulfovibrio desulfuricans
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1990-01-16, released 1991-01-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.093
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d6rxna_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rxnA (A:)
    mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa