PDB entry 6rwm

View 6rwm on RCSB PDB site
Description: SIVrcm intasome in complex with bictegravir
Class: recombination
Keywords: retroviral integrase, lentivirus, strand transfer inhibior, protein-DNA complex, RECOMBINATION
Deposited on 2019-06-05, released 2020-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: EM
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8 (1-End)
      • expression tag (0)
      • conflict (119)
  • Chain 'B':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8 (1-End)
      • conflict (119)
  • Chain 'C':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8
      • conflict (119)
    Domains in SCOPe 2.07: d6rwmc1, d6rwmc2
  • Chain 'D':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8
      • conflict (119)
    Domains in SCOPe 2.07: d6rwmd1, d6rwmd2
  • Chain 'E':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6rwme1, d6rwme2
  • Chain 'F':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rwmf1
  • Chain 'I':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8 (1-End)
      • expression tag (0)
      • conflict (119)
  • Chain 'J':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8 (1-End)
      • conflict (119)
  • Chain 'K':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8
      • conflict (119)
    Domains in SCOPe 2.07: d6rwmk1, d6rwmk2
  • Chain 'L':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8
      • conflict (119)
    Domains in SCOPe 2.07: d6rwml1, d6rwml2
  • Chain 'M':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1ANT8 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6rwmm1, d6rwmm2
  • Chain 'N':
    Compound: pol protein
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rwmn1
  • Chain 'Q':
    Compound: DNA (5'-d(*ap*ap*cp*tp*gp*gp*tp*ap*gp*ap*gp*ap*tp*tp*tp*tp*tp*cp*tp*tp*ap*gp*c)-3')
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: U5 vDNA end
  • Chain 'S':
    Compound: DNA (5'-d(*ap*ap*cp*tp*gp*gp*tp*ap*gp*ap*gp*ap*tp*tp*tp*tp*tp*cp*tp*tp*ap*gp*c)-3')
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: U5 vDNA end
  • Chain 'T':
    Compound: DNA (5'-d(p*gp*cp*tp*ap*ap*gp*ap*ap*ap*ap*ap*tp*cp*tp*cp*tp*ap*cp*cp*a)-3')
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: U5 vDNA end
  • Chain 'W':
    Compound: DNA (5'-d(p*gp*cp*tp*ap*ap*gp*ap*ap*ap*ap*ap*tp*cp*tp*cp*tp*ap*cp*cp*a)-3')
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: U5 vDNA end
  • Heterogens: KLQ, ZN, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6rwmC (C:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmC (C:)
    giekaqeehekyhnnwramaedfqipqvvakeivaqcpkcspktwqmdcthlegkviiva
    vhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngdnftssavqavcwwaqie
    htfggvvesmnhqlktiitqirdqaekietavqmavlihnfkrkggiggysageriidii
    asdlqttklqnqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6rwmD (D:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmD (D:)
    spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
    ngdnftssavqavcwwaqiehtfgvvesmnhqlktiitqirdqaekietavqmavlihnf
    krkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpatliwkg
    egavviqdgqdlkvvprrkckiikdyg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6rwmE (E:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmE (E:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6rwmF (F:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmF (F:)
    iiasdlqttklqnqiskiqnfrvyfregrdqqwkgpatliwkgegavviqdgqdlkvvpr
    rkckiikdy
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6rwmK (K:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmK (K:)
    giekaqeehekyhnnwramaedfqipqvvakeivaqcpkcspktwqmdcthlegkviiva
    vhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngdnftssavqavcwwaqie
    htfggvvesmnhqlktiitqirdqaekietavqmavlihnfkrkggiggysageriidii
    asdlqttklqnqi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6rwmL (L:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmL (L:)
    spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
    ngdnftssavqavcwwaqiehtfgvvesmnhqlktiitqirdqaekietavqmavlihnf
    krkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpatliwkg
    egavviqdgqdlkvvprrkckiikdyg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6rwmM (M:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmM (M:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6rwmN (N:)
    gfldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvkgeamhgqvdaspk
    twqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtdngd
    nftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietavqma
    vlihnfkrkggiggysageriidiiasdlqttklqnqiskiqnfrvyfregrdqqwkgpa
    tliwkgegavviqdgqdlkvvprrkckiikdygrkdvdsetsmegrqekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rwmN (N:)
    iiasdlqttklqnqiskiqnfrvyfregrdqqwkgpatliwkgegavviqdgqdlkvvpr
    rkckiikdy
    

  • Chain 'Q':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'W':
    No sequence available.