PDB entry 6rsn

View 6rsn on RCSB PDB site
Description: soseki polymerising domain (sok4 d85a mutant)
Deposited on 2019-05-21, released 2020-01-29
The last revision was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPSTREAM OF FLC-like protein (DUF966)
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g46110
    Database cross-references and differences (RAF-indexed):
    • Uniprot F4J7X6 (Start-94)
      • engineered mutation (70)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6rsnA (A:)
srerivpvvyylsrngrldhphfievplsshnglylkdvinrlndlrgngmaclyswssk
rtykngfvwyalsdedfifpvhgqeyvlkgsqild

    Sequence, based on observed residues (ATOM records):
    >6rsnA (A:)
rivpvvyylsrngrldhphfievplsshnglylkdvinrlndlrgngmaclyswsskrty
kngfvwyalsdedfifpvhgqeyvlkgsqild