PDB entry 6rsk

View 6rsk on RCSB PDB site
Description: Cytochrome c co-crystallized with 20 eq. sulfonato-calix[8]arene and 15 eq. spermine - structure II
Class: oxidoreductase
Keywords: Molecular glues, Molecular switch, spermine, polyamine, calixarene, supramolecular chemistry, OXIDOREDUCTASE
Deposited on 2019-05-21, released 2019-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6rska1, d6rska2
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6rskb1, d6rskb2
  • Heterogens: SPM, EVB, HEC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rskA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rskB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate