PDB entry 6rsk

View 6rsk on RCSB PDB site
Description: Cytochrome c co-crystallized with 20 eq. sulfonato-calix[8]arene and 15 eq. spermine - structure II
Class: oxidoreductase
Keywords: Molecular glues, Molecular switch, spermine, polyamine, calixarene, supramolecular chemistry, OXIDOREDUCTASE
Deposited on 2019-05-21, released 2019-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (1-107)
    • expression tag (0)
    • engineered mutation (106)
  Domains in SCOPe 2.07: d6rska1, d6rska2
• Chain 'B':
  Compound: Cytochrome c iso-1
  Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (1-107)
    • expression tag (0)
    • engineered mutation (106)
  Domains in SCOPe 2.07: d6rskb1, d6rskb2
• Heterogens: SPM, EVB, HEC, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6rskA (A:)
  aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6rskB (B:)
  aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate