PDB entry 6rsj

View 6rsj on RCSB PDB site
Description: Cytochrome c co-crystallized with 20 eq. sulfonato-calix[8]arene and soaked with 25 eq. spermine - structure I
Class: oxidoreductase
Keywords: Molecular glues, Molecular switch, spermine, polyamine, calixarene, supramolecular chemistry, OXIDOREDUCTASE, cytc
Deposited on 2019-05-21, released 2019-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d6rsja1, d6rsja2
  • Heterogens: EVB, SPM, HEC, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rsjA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate