PDB entry 6rsa

View 6rsa on RCSB PDB site
Description: nuclear magnetic resonance and neutron diffraction studies of the complex of ribonuclease*a with uridine vanadate, a transition-state analogue
Class: hydrolase
Keywords: hydrolase
Deposited on 1986-02-25, released 1986-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: NEUT;NMR
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00656 (0-123)
  Domains in SCOPe 2.07: d6rsaa_
• Heterogens: UVC, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6rsaA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv