PDB entry 6rsa

View 6rsa on RCSB PDB site
Description: nuclear magnetic resonance and neutron diffraction studies of the complex of ribonuclease*a with uridine vanadate, a transition-state analogue
Deposited on 1986-02-25, released 1986-05-07
The last revision prior to the SCOP 1.61 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NEUT;XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d6rsa__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6rsa_ (-)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv