PDB entry 6rqw

View 6rqw on RCSB PDB site
Description: X-ray crystal structure of perdeuterated (D) small monoclinic unit cell CA IX SV.
Class: proton transport
Keywords: carbonic anhydrase, CA IX, surface variant, PROTON TRANSPORT
Deposited on 2019-05-16, released 2019-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (0-255)
      • engineered mutation (34)
      • engineered mutation (43)
      • engineered mutation (73)
      • engineered mutation (118-119)
      • engineered mutation (210)
    Domains in SCOPe 2.08: d6rqwa_
  • Heterogens: ZN, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rqwA (A:)
    hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng
    hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky
    arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps
    dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq
    plngrvieasfpagvd