PDB entry 6rpp

View 6rpp on RCSB PDB site
Description: crystal structure of pabcdc21-1 intein
Deposited on 2019-05-14, released 2019-08-14
The last revision was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein
    Species: Pyrococcus abyssi (strain GE5 / Orsay) [TaxId:272844]
    Gene: cdc21, PAB2373
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UYR7 (1-166)
      • expression tag (0)
      • engineered mutation (3)
      • engineered mutation (166)
      • expression tag (167)
  • Heterogens: ACT, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6rppA (A:)
sakavdyetevvlgngerkkigeiveraieeaekngklgrvddgfyapidievysldlet
lkvrkaraniawkrtapkkmmlvktrggkrirvtpthpffvleegkvamrkardleegnk
iatieglsvswdevaeileyepkdpwvydlqvpgyhnflangifvhaa