PDB entry 6rpk

View 6rpk on RCSB PDB site
Description: non-expanded bat circovirus with dna vlp
Deposited on 2019-05-14, released 2020-11-25
The last revision was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: EM
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'u':
    Compound: capsid protein
    Species: Bat circovirus [TaxId:1329650]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A3G6IPQ0 (10-200)
      • expression tag (0-9)
      • conflict (15-18)
      • conflict (25)
      • conflict (52-53)
      • conflict (67-68)
      • conflict (70)
      • conflict (99-100)
      • conflict (108-109)
      • conflict (132)
      • conflict (174-175)
      • conflict (186)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records:
    >6rpku (u:)
rfraryrwrrkngitnlrltrqvelwvpkdaanasfyvnhytfdlddfipagtqlnsspl
pfkyyrirkvkvefqprlpitspfrgygstvpildgafvtpatgesdpiwdpyinfsgrh
virtpawyhkryftpkplidgntgffqpnnkqnalwfpnkqgqniqwsglgfamqkgnea
ynyqvrftlyvqfrefdlfnn