PDB entry 6rp5

View 6rp5 on RCSB PDB site
Description: Crystal structure of monocarboxylated hemoglobin from the sub-Antarctic fish Eleginops maclovinus
Class: oxygen transport
Keywords: hemoglobin, sub-Antarctic fish, Eleginops maclovinus, OXYGEN TRANSPORT
Deposited on 2019-05-13, released 2019-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha 1
    Species: Eleginops maclovinus [TaxId:56733]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6rp5a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-1
    Species: Eleginops maclovinus [TaxId:56733]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6rp5b_
  • Heterogens: CMO, HEM, SO4, DTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6rp5A (A:)
slsdkdkaavkllwskiskssdaigndalsrmivvypqtktyfahwpdlspgsphvkahg
ktvmggialavskiddlraglldlseqhayklrvdpanfkilshcilvvismmfpkeftp
eahvsldkflsgvslalseryr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6rp5B (B:)
vewtdqeratissifgsldyddigpkalsrclivypwtqrhfgsfgnlynaeaiignqkv
aahgikvlhgldravknmdnikeiyaelsilhseklhvdpdnfklladcltivvaakmgs
gfnpgtqatfqkflavvvsalgkq