PDB entry 6rjn

View 6rjn on RCSB PDB site
Description: Crystal structure of a Fungal Catalase at 2.3 Angstroms
Class: oxidoreductase
Keywords: Pichia pastoris, Catalase, Heme, NADP, OXIDOREDUCTASE
Deposited on 2019-04-28, released 2020-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Komagataella pastoris [TaxId:4922]
    Gene: CTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rjna_
  • Chain 'B':
    Compound: catalase
    Species: Komagataella pastoris [TaxId:4922]
    Gene: CTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rjnb_
  • Chain 'C':
    Compound: catalase
    Species: Komagataella pastoris [TaxId:4922]
    Gene: CTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rjnc_
  • Chain 'D':
    Compound: catalase
    Species: Komagataella pastoris [TaxId:4922]
    Gene: CTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rjnd_
  • Heterogens: HEM, NDP, GOL, SO4, CL, K, NA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6rjnA (A:)
    gamsqppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdre
    ripervvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsar
    dprgfstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylv
    nnqesihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnn
    eeagklagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkd
    fplrrfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlg
    vnyqqipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeev
    laahtekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrv
    feyfskvypeigdqirkevlqlsprgdsaarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rjnA (A:)
    qppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdreripe
    rvvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsardprg
    fstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylvnnqe
    sihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnneeag
    klagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkdfplr
    rfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlgvnyq
    qipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeevlaah
    tekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrvfeyf
    skvypeigdqirkevlqlsprg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6rjnB (B:)
    gamsqppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdre
    ripervvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsar
    dprgfstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylv
    nnqesihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnn
    eeagklagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkd
    fplrrfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlg
    vnyqqipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeev
    laahtekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrv
    feyfskvypeigdqirkevlqlsprgdsaarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rjnB (B:)
    qppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdreripe
    rvvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsardprg
    fstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylvnnqe
    sihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnneeag
    klagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkdfplr
    rfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlgvnyq
    qipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeevlaah
    tekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrvfeyf
    skvypeigdqirkevlqlsprg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6rjnC (C:)
    gamsqppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdre
    ripervvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsar
    dprgfstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylv
    nnqesihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnn
    eeagklagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkd
    fplrrfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlg
    vnyqqipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeev
    laahtekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrv
    feyfskvypeigdqirkevlqlsprgdsaarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rjnC (C:)
    qppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdreripe
    rvvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsardprg
    fstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylvnnqe
    sihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnneeag
    klagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkdfplr
    rfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlgvnyq
    qipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeevlaah
    tekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrvfeyf
    skvypeigdqirkevlqlsprg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6rjnD (D:)
    gamsqppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdre
    ripervvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsar
    dprgfstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylv
    nnqesihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnn
    eeagklagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkd
    fplrrfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlg
    vnyqqipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeev
    laahtekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrv
    feyfskvypeigdqirkevlqlsprgdsaarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rjnD (D:)
    qppkwttsngapvsdvfateratfdnanhannapkvgplllqdfqlidslahfdreripe
    rvvhakgagafgefevtddisdvcaakfldtigkktriftrfstvggekgsadsardprg
    fstkfyteegnldlvynntpiffirdpskfphfihtqkrnpatnlkdanmfwdylvnnqe
    sihqvmylfsdrgtpaslrkmngysghtykwynkkgewvyvqvhfksdlgvvnfnneeag
    klagedpdyhtgdlfnaiergeypswtcyiqtmtqeqaakqpfsvfdltkvwphkdfplr
    rfgkftlnenpknyfaeveqaafspshtipsmqpsadpvlqsrlfsypdthrhrlgvnyq
    qipvncpvapvftpqmrdgsmtvngnlgstpnykssfcpfsteaqiqtnshtpeevlaah
    tekfhwggildsksydfeqpralwkvfgktpgqqrnfchnvavhvaaanheiqdrvfeyf
    skvypeigdqirkevlqlsprg