PDB entry 6rjc

View 6rjc on RCSB PDB site
Description: E.coli transketolase apoenzyme
Class: transferase
Keywords: thiamin diphosphate, enzyme catalysis, pentose phosphate pathway, transferase
Deposited on 2019-04-26, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transketolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tktA, tkt, b2935, JW5478
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663-665)
    Domains in SCOPe 2.07: d6rjca1, d6rjca2, d6rjca3, d6rjca4
  • Chain 'B':
    Compound: Transketolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tktA, tkt, b2935, JW5478
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663-667)
    Domains in SCOPe 2.07: d6rjcb1, d6rjcb2, d6rjcb3, d6rjcb4
  • Heterogens: CA, EDO, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6rjcA (A:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rjcA (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6rjcB (B:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rjcB (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhhhhh