PDB entry 6rgx

View 6rgx on RCSB PDB site
Description: tetr(d) n82a mutant in complex with doxycycline and magnesium
Class: transcription
Keywords: transcription regulation, transcription
Deposited on 2019-04-17, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-206)
      • expression tag (0)
      • conflict (80)
    Domains in SCOPe 2.07: d6rgxa1, d6rgxa2, d6rgxa3
  • Chain 'B':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-206)
      • expression tag (0)
      • conflict (80)
    Domains in SCOPe 2.07: d6rgxb1, d6rgxb2, d6rgxb3
  • Heterogens: DXT, CL, PG4, PGE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rgxA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6rgxB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rgxB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaallppllrealqimdsddgeqaflhgle
    slirgfevqltallqiv