PDB entry 6rgn

View 6rgn on RCSB PDB site
Description: btea131
Deposited on 2019-04-17, released 2019-09-18
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DUF3120 domain-containing protein
    Species: Bordetella pertussis [TaxId:520]
    Gene: EHO76_17700, NCTC10911_04001
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6rgnA (A:)
mgsshhhhhhssglvprgshmlsnnvnpvvglsyrplpetppsgqaaahpsmrllepnnd
efvrsvasprlhhssealrevkhdvrqfqasgdrslqqlrdlevalnhweasqprefakr
ggmvaelrtaidaykqqlheqapshanldvk

    Sequence, based on observed residues (ATOM records):
    >6rgnA (A:)
hpsmrllepnndefvrsvasprlhhssealrevkhdvrqfqasgdrslqqlrdlevalnh
weasqprefakrggmvaelrtaidaykqqlheq