PDB entry 6rgi

View 6rgi on RCSB PDB site
Description: Partially unfolded cytochrome c in complex with sulfonatocalix[6]arene
Class: electron transport
Keywords: molecular glues, calixarene, protein assembly, supramolecular chemistry, ELECTRON TRANSPORT
Deposited on 2019-04-16, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d6rgia_
  • Heterogens: HEC, FWQ, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6rgiA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rgiA (A:)
    efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsnvlwdennmseyltnp
    kkyipgtkmafgglkkekdrndlitylkkate