PDB entry 6rep

View 6rep on RCSB PDB site
Description: Cryo-EM structure of Polytomella F-ATP synthase, Primary rotary state 3, composite map
Class: proton transport
Keywords: mitochondrial ATP synthase dimer flexible coupling cryoEM, PROTON TRANSPORT
Deposited on 2019-04-12, released 2019-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain '0':
  Compound: ASA-10: Polytomella F-ATP synthase associated subunit 10
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • PDB 6REP (Start-81)
• Chain '1':
  Compound: ATP synthase associated protein ASA1
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q85JD5
• Chain '2':
  Compound: ASA-2: Polytomella F-ATP synthase associated subunit 2
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • PDB 6REP (0-440)
• Chain '3':
  Compound: Mitochondrial F1F0 ATP synthase associated 32 kDa protein
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot K0J903
• Chain '4':
  Compound: Mitochondrial ATP synthase associated protein ASA4
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7NIZ2 (Start-293)
• Chain '5':
  Compound: Mitochondrial F1F0 ATP synthase associated 14 kDa protein
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A024FSR7 (0-122)
• Chain '6':
  Compound: Mitochondrial ATP synthase subunit ASA6
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P897 (Start-150)
• Chain '7':
  Compound: Mitochondrial ATP synthase associated protein ASA7
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D8V7I2 (Start-189)
• Chain '8':
  Compound: Mitochondrial ATP synthase subunit ASA8
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D8V7I7 (Start-88)
• Chain '9':
  Compound: ASA-9: Polytomella F-ATP synthase associated subunit 9
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • PDB 6REP (0-96)
• Chain 'A':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'B':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'C':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'D':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'E':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'F':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'G':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'H':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'I':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'J':
  Compound: Mitochondrial ATP synthase subunit c
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X5 (Start-126)
• Chain 'M':
  Compound: Mitochondrial ATP synthase subunit 6
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot H8PGG3
• Chain 'P':
  Compound: Mitochondrial ATP synthase subunit OSCP
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D8V7I1 (Start-228)
• Chain 'Q':
  Compound: epsilon: Polytomella F-ATP synthase epsilon subunit
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • PDB 6REP (Start-73)
• Chain 'R':
  Compound: Mitochondrial ATP synthase subunit delta
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7P7X6 (Start-198)
• Chain 'S':
  Compound: ATP synthase gamma chain, mitochondrial
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q4LDE7
  Domains in SCOPe 2.08: d6reps_
• Chain 'T':
  Compound: ATP synthase subunit alpha
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0ZW40 (Start-561)
    • conflict (265)
• Chain 'U':
  Compound: ATP synthase subunit alpha
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0ZW40 (Start-561)
    • conflict (265)
• Chain 'V':
  Compound: ATP synthase subunit alpha
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0ZW40 (Start-561)
    • conflict (265)
• Chain 'X':
  Compound: ATP synthase subunit beta
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0ZW41 (Start-573)
    • conflict (349)
    • conflict (386)
• Chain 'Y':
  Compound: ATP synthase subunit beta
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0ZW41
    • conflict (349)
    • conflict (386)
• Chain 'Z':
  Compound: ATP synthase subunit beta
  Species: Polytomella sp. Pringsheim 198.80 [TaxId:37502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0ZW41 (Start-573)
    • conflict (349)
    • conflict (386)
• Heterogens: ZN, ATP, MG, ADP, HOH

PDB Chain Sequences:

• Chain '0':
  No sequence available.
  
  
• Chain '1':
  No sequence available.
  
  
• Chain '2':
  No sequence available.
  
  
• Chain '3':
  No sequence available.
  
  
• Chain '4':
  No sequence available.
  
  
• Chain '5':
  No sequence available.
  
  
• Chain '6':
  No sequence available.
  
  
• Chain '7':
  No sequence available.
  
  
• Chain '8':
  No sequence available.
  
  
• Chain '9':
  No sequence available.
  
  
• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  Sequence, based on SEQRES records: (download)
  

  >6repS (S:)
  malrkavlslglsqgvaaeavlgsgmfnavqhesvryasnqavkqriraiknigkitkam
  kmvaaskmknaqiaveqsrglvdpfvrlfgdfpavnsnksvvvavtsdkglcgglnsnit
  kytratlattesegkdvvvvsigdkgrsqltriesqryqlaiadtykvrvtfgqaslive
  elikhnpqsyqilfnkfrsaisfkptvatilspdllekqledvtgnsldaydieashers
  dvlrdltefhlgvtlynamlenncsehasrmsamenstksagemlgkltldynrkrqati
  ttelieiiagasalmde
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6repS (S:)
  snqavkqriraiknigkitkamkmvaaskmknaqiaveqsrglvdpfvrlfgdfpavnsn
  ksvvvavtsdkglcgglnsnitkytratlattesegkdvvvvsigdkgrsqltriesqry
  qlaiadtykvrvtfgqasliveelikhnpqsyqilfnkfrsaisfkptvatilspdllek
  qledvtgnsldaydieashersdvlrdltefhlgvtlynamlenncsehasrmsamenst
  ksagemlgkltldynrkrqatittelieiiagasalm
  

  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.
  
  
• Chain 'Z':
  No sequence available.