PDB entry 6rcr

View 6rcr on RCSB PDB site
Description: tetr(d) h100a mutant in complex with doxycycline and magnesium
Class: transcription
Keywords: transcription regulation, transcription
Deposited on 2019-04-11, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • engineered mutation (0)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d6rcra1, d6rcra2
  • Heterogens: DXT, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6rcrA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rcrA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtadenlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv