PDB entry 6r8x

View 6r8x on RCSB PDB site
Description: coagulation factor xi catalytic domain in complex with fab-portion of maa868
Class: blood clotting
Keywords: Coagulation FXI, Zymogen, Antibody, Antagonist, BLOOD CLOTTING
Deposited on 2019-04-02, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951
      • engineered mutation (112)
    Domains in SCOPe 2.07: d6r8xa_
  • Chain 'B':
    Compound: anti-Factor-XI Fab fragment light chain MAA868
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 6R8X
  • Chain 'C':
    Compound: anti-Factor-XI Fab fragment heavy chain MAA868
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 6R8X (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6r8xA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6r8xA (A:)
    tasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysgilnq
    seikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdrnviy
    tdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreackgds
    ggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.