PDB entry 6r8c

View 6r8c on RCSB PDB site
Description: HIV capsid hexamer with IP5 ligand
Class: viral protein
Keywords: hiv, viral protein
Deposited on 2019-04-01, released 2020-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DRA0 (0-204)
      • conflict (13)
      • conflict (44)
    Domains in SCOPe 2.08: d6r8ca1, d6r8ca2
  • Heterogens: 5MY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6r8cA (A:)
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnpp
ipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllvqna
npdcktilkalgpgatleemmtacq