PDB entry 6r7j

View 6r7j on RCSB PDB site
Description: Ligand complex of RORg LBD
Class: transcription
Keywords: RAR-related Orphan Receptor-g (RORg), TRANSCRIPTION, RORG LIGAND, STRUCTURE-BASED DESIGN
Deposited on 2019-03-29, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (22-264)
      • expression tag (15-21)
      • expression tag (265-266)
    Domains in SCOPe 2.07: d6r7ja1, d6r7ja2, d6r7ja3
  • Chain 'C':
    Compound: SRC2 peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6R7J
  • Heterogens: JUN, DMS, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6r7jA (A:)
    mhnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsr
    eevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvl
    vrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialyta
    lvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhver
    lqifqhlhpivvqaafpplykelfsgggkekhkilhrllqdss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6r7jA (A:)
    enlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemw
    ercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvf
    fegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekr
    kveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaa
    fpplykelfsgg
    

  • Chain 'C':
    No sequence available.