PDB entry 6r6n

View 6r6n on RCSB PDB site
Description: recombinantly produced kusta0087/kusta0088 complex, c32m/c101m mutant
Deposited on 2019-03-27, released 2019-10-02
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small soluble cyt c
    Species: Kuenenia stuttgartiensis [TaxId:174633]
    Gene: KSMBR1_3082, kusta0087
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1Q7P4 (0-110)
      • cloning artifact (0)
      • engineered mutation (7)
  • Chain 'B':
    Compound: Kusta0088
    Species: Kuenenia stuttgartiensis [TaxId:174633]
    Gene: KSMBR1_3083, kusta0088
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1Q7P3 (0-99)
      • engineered mutation (74)
  • Heterogens: HEC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6r6nA (A:)
aatqqeimknmwdpfqsmravtglmeltsgqctqlskdaaailagvkeshdsisvdknyk
vlndevayhaanidaaakandleevqvqfrrmtiacrnchkiykteqrlvp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6r6nB (B:)
lnehtagdttkspytiyaglgfavqescyychgnggkgtteglifgvpdftstefqssmt
dkqiidhinkgkgkmpsyqgkmspemiekmagvvrnfavk