PDB entry 6r6m

View 6r6m on RCSB PDB site
Description: kusta0087/kusta0088 complex purified from kuenenia stuttgartiensis
Deposited on 2019-03-27, released 2019-10-02
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small soluble cyt c
    Species: Kuenenia stuttgartiensis [TaxId:174633]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Kusta0088
    Species: Kuenenia stuttgartiensis [TaxId:174633]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6r6mA (A:)
atqqeicknmwdpfqsmravtglmeltsgqctqlskdaaailagvkeshdsisvdknykv
lndevayhaanidaaakandleevqvqfrrmtiacrnchkiykteqrlvp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6r6mB (B:)
lnehtagdttkspytiyaglgfavqescyychgnggkgtteglifgvpdftstefqssmt
dkqiidhinkgkgkcpsyqgkmspemiekmagvvrnfavk