PDB entry 6r5g

View 6r5g on RCSB PDB site
Description: c-sh2 domain of shp-2 in complex with phospho-itsm of pd-1
Deposited on 2019-03-25, released 2020-02-05
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (3-118)
      • expression tag (0-2)
  • Chain 'B':
    Compound: itsm
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6R5G (0-10)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6r5gA (A:)
gpmadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesn
dgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6r5gB (B:)
eqteyativfp