PDB entry 6r3y

View 6r3y on RCSB PDB site
Description: M.tuberculosis nitrobindin with a cyanide molecule coordinated to the heme iron atom
Class: protein binding
Keywords: hemeproteins, beta-barrel, peroxynitrite detoxification, PROTEIN BINDING
Deposited on 2019-03-21, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0678 fatty acid-binding protein-like protein ERS007657_00996
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6r3ya_
  • Heterogens: HEM, CYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6r3yA (A:)
    mtrdlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravad
    gkplhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglap
    takevtaldrsyridgdelsyslqmravgqplqdhlaavlhrqrrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6r3yA (A:)
    dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp
    lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak
    evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr