PDB entry 6r3w

View 6r3w on RCSB PDB site
Description: M.tuberculosis nitrobindin with a water molecule coordinated to the heme iron atom
Class: protein binding
Keywords: heme-protein, beta-barrel, peroxynitrite detossification, PROTEIN BINDING
Deposited on 2019-03-21, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UPF0678 fatty acid-binding protein-like protein ERS007657_00996
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: ERS007657_00996, ERS007661_00585, ERS007665_01763, ERS007670_02052, ERS007672_00691, ERS007679_01339, ERS007681_01416, ERS007688_01403, ERS007703_01571, ERS007720_01340, ERS007722_02241, ERS007726_02281, ERS007734_00360, ERS007737_00208, ERS007741_02326, ERS023446_01189, ERS024213_01977, ERS027644_00434, ERS027646_00714, ERS027651_02146, ERS027652_02045, ERS027653_02567, ERS027656_02331, ERS027659_01673, ERS027661_03351, ERS027666_00865, ERS031537_00196, ERS124361_02201, SAMEA2682864_02059, SAMEA2683035_01682
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0E8TXJ8 (Start-163)
  Domains in SCOPe 2.08: d6r3wa_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6r3wA (A:)
  mtrdlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravad
  gkplhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglap
  takevtaldrsyridgdelsyslqmravgqplqdhlaavlhrqrrshhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6r3wA (A:)
  dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp
  lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak
  evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr