PDB entry 6r1q

View 6r1q on RCSB PDB site
Description: murine Neuroglobin under 2 kBar of argon
Class: oxygen storage
Keywords: neuroglobin, argon, high pressure, OXYGEN STORAGE
Deposited on 2019-03-14, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (0-147)
      • engineered mutation (52)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d6r1qa_
  • Heterogens: SO4, HEM, AR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6r1qA (A:)
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg