PDB entry 6r1l

View 6r1l on RCSB PDB site
Description: Crystal structure of LmrR with bound copper phenanthroline
Class: DNA binding protein
Keywords: PadR family, transcriptional regulator, artificial metalloenzyme, phenanthroline, DNA BINDING PROTEIN
Deposited on 2019-03-14, released 2020-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris (strain MG1363) [TaxId:416870]
    Gene: llmg_0323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6r1la_
  • Heterogens: PHN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6r1lA (A:)
maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaiksrws
hpqfek

    Sequence, based on observed residues (ATOM records): (download) 
    >6r1lA (A:)
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdgrrkyyrlteighenmrlafeswsrvdkiienlea