PDB entry 6r01

View 6r01 on RCSB PDB site
Description: streptomyces lividans ccsp mutant - h107a/h111a
Deposited on 2019-03-12, released 2019-07-10
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosolic copper storage protein
    Species: Streptomyces lividans 1326 [TaxId:1200984]
    Gene: SCO3281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X8F4 (0-118)
      • engineered mutation (90)
      • engineered mutation (94)
  • Heterogens: CU1, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6r01A (A:)
ggvdreamarcieeclrcaqactacadaclseptvadltkcirtdmdcadvctataavls
rhtgydanvtravlqacatvcaacgdecaraagmaehcrvcaeacrsceqacqellagl