PDB entry 6qvg

View 6qvg on RCSB PDB site
Description: Human SHMT2 in complex with lometrexol
Class: transferase
Keywords: transferase
Deposited on 2019-03-01, released 2019-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qvga_
  • Chain 'B':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qvgb_
  • Heterogens: DDF, GLY, PEG, NA, GOL, PLP, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qvgA (A:)
    mlyfslfwaarplqrcgqlvrmairaqhsnaaqtqtgeanrgwtgqeslsdsdpemwell
    qrekdrqcrgleliasenfcsraalealgsclnnkysegypgkryyggaevvdeiellcq
    rraleafdldpaqwgvnvqpysgspanlavytallqphdrimgldlpdgghlthgymsdv
    krisatsiffesmpyklnpktglidynqlaltarlfrprliiagtsayarlidyarmrev
    cdevkahlladmahisglvaakvipspfkhadivtttthktlrgarsglifyrkgvkavd
    pktgreipytfedrinfavfpslqggphnhaiaavavalkqactpmfreyslqvlknara
    madallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitankntcpgdrsait
    pgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksfllkdsetsq
    rlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qvgA (A:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkipytfedrinfavfpslqggphnhaiaavavalkqactpmfreys
    lqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitanknt
    cpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksf
    llkdsetsqrlanlrqrveqfarafpmpgfdeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qvgB (B:)
    mlyfslfwaarplqrcgqlvrmairaqhsnaaqtqtgeanrgwtgqeslsdsdpemwell
    qrekdrqcrgleliasenfcsraalealgsclnnkysegypgkryyggaevvdeiellcq
    rraleafdldpaqwgvnvqpysgspanlavytallqphdrimgldlpdgghlthgymsdv
    krisatsiffesmpyklnpktglidynqlaltarlfrprliiagtsayarlidyarmrev
    cdevkahlladmahisglvaakvipspfkhadivtttthktlrgarsglifyrkgvkavd
    pktgreipytfedrinfavfpslqggphnhaiaavavalkqactpmfreyslqvlknara
    madallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitankntcpgdrsait
    pgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksfllkdsetsq
    rlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qvgB (B:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkaipytfedrinfavfpslqggphnhaiaavavalkqactpmfrey
    slqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitankn
    tcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfks
    fllkdsetsqrlanlrqrveqfarafpmpgfdeh