PDB entry 6qv9

View 6qv9 on RCSB PDB site
Description: Staphylococcus aureus superoxide dismutase SodA double mutant
Class: oxidoreductase
Keywords: superoxide dismutase, cambialistic, staphylococcus aureus, oxidoreductase, metalloenzyme
Deposited on 2019-03-01, released 2020-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodA_1, BN1321_260190, BTN44_04405, CSC83_01345, CSC87_02560, CV021_16580, EP54_01115, EQ90_12445, ERS072840_00871, HMPREF3211_01704, M1K003_1305, NCTC10654_01617, NCTC11940_01488, NCTC13131_01937, NCTC13196_02481, RK64_08340, SAMEA1466939_00978, SAMEA1708674_02019
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8TT57
      • conflict (158-159)
    Domains in SCOPe 2.07: d6qv9a1, d6qv9a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodA_1, BN1321_260190, BTN44_04405, CSC83_01345, CSC87_02560, CV021_16580, EP54_01115, EQ90_12445, ERS072840_00871, HMPREF3211_01704, M1K003_1305, NCTC10654_01617, NCTC11940_01488, NCTC13131_01937, NCTC13196_02481, RK64_08340, SAMEA1466939_00978, SAMEA1708674_02019
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8TT57
      • conflict (158-159)
    Domains in SCOPe 2.07: d6qv9b1, d6qv9b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qv9A (A:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpillfdvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qv9A (A:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    svpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaa
    arfgsgwawlvvnngqleivttpnqdnpltegktpillfdvwehayylkyqnkrpdyiga
    fwnvvnwekvdelynat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qv9B (B:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpillfdvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qv9B (B:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    svpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaa
    arfgsgwawlvvnngqleivttpnqdnpltegktpillfdvwehayylkyqnkrpdyiga
    fwnvvnwekvdelynat