PDB entry 6qv8

View 6qv8 on RCSB PDB site
Description: Staphylococcus aureus superoxide dismutase SodM double mutant
Class: oxidoreductase
Keywords: superoxide dismutase, cambialistic, staphylococcus aureus, oxidoreductase, metalloenzyme
Deposited on 2019-03-01, released 2020-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodM, BN1321_40056, BTN44_00625, CSC83_08500, CV021_03995, EP54_06740, EQ90_09180, ERS072840_00559, HMPREF3211_00238, M1K003_0636, NCTC10654_00163, NCTC10702_00282, NCTC11940_00074, NCTC13131_06218, NCTC13196_01115, NCTC5664_00801, RK64_01130, SAMEA1466939_02412, SAMEA1708674_03236
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8UU58 (Start-198)
      • conflict (158-159)
    Domains in SCOPe 2.07: d6qv8a1, d6qv8a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodM, BN1321_40056, BTN44_00625, CSC83_08500, CV021_03995, EP54_06740, EQ90_09180, ERS072840_00559, HMPREF3211_00238, M1K003_0636, NCTC10654_00163, NCTC10702_00282, NCTC11940_00074, NCTC13131_06218, NCTC13196_01115, NCTC5664_00801, RK64_01130, SAMEA1466939_02412, SAMEA1708674_03236
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8UU58 (Start-198)
      • conflict (158-159)
    Domains in SCOPe 2.07: d6qv8b1, d6qv8b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qv8A (A:)
    mafklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianl
    dkvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefanka
    ttlfgsgwtwlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdymt
    afwnivnwkkvdelyqaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qv8A (A:)
    afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
    kvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefankat
    tlfgsgwtwlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdymta
    fwnivnwkkvdelyqaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qv8B (B:)
    mafklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianl
    dkvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefanka
    ttlfgsgwtwlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdymt
    afwnivnwkkvdelyqaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qv8B (B:)
    afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
    kvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefankat
    tlfgsgwtwlvvndgkleivttpnqdnpltegktpilgldvwehayylkyqnkrpdymta
    fwnivnwkkvdelyqaak