PDB entry 6qsy

View 6qsy on RCSB PDB site
Description: engineered streptavidin variant (h--wy) in complex with the strep-tag ii peptide
Deposited on 2019-02-22, released 2020-03-18
The last revision was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • conflict (31-32)
      • conflict (34)
      • engineered mutation (104)
      • engineered mutation (106)
  • Chain 'P':
    Compound: strep-tag II peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6QSY
  • Heterogens: PGE, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6qsyA (A:)
meagitgtwynqlgstfivtagadgaltgtyvtargnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgttehwystlvghdtftkvk
psaas

    Sequence, based on observed residues (ATOM records):
    >6qsyA (A:)
agitgtwynqlgstfivtagadgaltgtyvtargnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgttehwystlvghdtftkvkp

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6qsyP (P:)
xsawshpqfek

    Sequence, based on observed residues (ATOM records):
    >6qsyP (P:)
awshpqfek