PDB entry 6qs0

View 6qs0 on RCSB PDB site
Description: nmr structure of bb_a03, borrelia burgdorferi outer surface lipoprotein
Deposited on 2019-02-20, released 2020-03-18
The last revision was dated 2021-02-17, with a file datestamp of 2021-02-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative outer membrane protein BBA03
    Species: Borreliella burgdorferi B31 [TaxId:224326]
    Gene: BB_A03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44849 (4-121)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6qs0A (A:)
gamgtpleklvsrlnlnnteketltfltnllkeklvdpniglhfknsggdeskieesvqk
flselkedeikdllakikenkdkkekdpeelntyksilasgfdgifnqadskttlnklkd
ti